Protein Info for Sama_2264 in Shewanella amazonensis SB2B

Annotation: ClpX, ATPase regulatory subunit (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 827 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF02563: Poly_export" amino acids 136 to 209 (74 residues), 51.4 bits, see alignment E=1.5e-17 PF22461: SLBB_2" amino acids 217 to 294 (78 residues), 28.2 bits, see alignment E=2.5e-10 amino acids 496 to 580 (85 residues), 30.5 bits, see alignment E=4.9e-11 PF10531: SLBB" amino acids 218 to 267 (50 residues), 21.6 bits, see alignment 2.4e-08 amino acids 301 to 348 (48 residues), 30.9 bits, see alignment 2.9e-11 amino acids 386 to 410 (25 residues), 16.4 bits, see alignment (E = 9.7e-07) amino acids 498 to 540 (43 residues), 27 bits, see alignment 4.7e-10 amino acids 592 to 633 (42 residues), 29.6 bits, see alignment 7.4e-11 amino acids 723 to 771 (49 residues), 27.7 bits, see alignment 3e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_2264)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7W3 at UniProt or InterPro

Protein Sequence (827 amino acids)

>Sama_2264 ClpX, ATPase regulatory subunit (RefSeq) (Shewanella amazonensis SB2B)
MLQQLKRFLIAGVGALVLVGGPVAAITPSPQMIEQFKNLPKAEQERIARQYGIDPSMLSG
QATQPTIVNPEVVAPRNTGSTTEVVNQSETDAFNQATKTESQIEAREEELEKQLKRFGYD
MFAGEPSTFAPVSDVPVPAEYMMGPGDVLNVQLYGKENKNFSLTVGRDGLVQFPDLGPIS
LVGMSFSEAKNFLTDKIAQSMIGIQANITMGELRSIRIFVAGDAYRPGSYTVSSLSTITQ
ALFVSGGINEIGSLRNIQLKRAGRTVGTFDLYDLLLAGDASKDLRLQSGDVVFIPSVGGL
VSVTGEVRRPAIYEIKANDTMADVLNMASGAKPGAYPEASTIERFSKDVKTVINVDLTQA
SGLSVKAKAGDLVRVKSTSTRIDNAVTLVGAVVRPGKYQYRNGMRLRDMLPSIWGDLTLN
ADLDYGLLVREINQRGDVKVIQVSVGKAISGDDSANIALQPRDTLMVFDYADRATLLEPV
ITQLRQQSRFGDAIKLADINGSVRFPGKYPITEGATIKDLLVAAGGLKEGAYTLSAELTR
QNISEQTGVTVTHQQLSLQDVLLNDPSANIALQSRDVLTVRDLPDWQDTRWVTIKGEVRF
PGTYSIQRGETLKHVLSRAGGLSEDAAPRSAVFLRESVKQKEKTELLKLSDELRREIAAK
ALTKDTPTVGYADAQNMLKELENVEVLGRLVVDINAIQLGIDEADLKLEDGDALFIPAQN
QTVSVMGQVQHPSTHRYKKGFTFDQYLELAGGPRKRADDDRAYILRADGSVAMPGSSYWF
STDEEMQPGDTIVMPLDTEYKDNLTLWSQVTQIIYNTAVAVATISGL