Protein Info for Sama_2200 in Shewanella amazonensis SB2B

Annotation: serine/threonine transporter SstT (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 7 to 32 (26 residues), see Phobius details amino acids 47 to 70 (24 residues), see Phobius details amino acids 82 to 104 (23 residues), see Phobius details amino acids 141 to 161 (21 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 213 to 237 (25 residues), see Phobius details amino acids 289 to 314 (26 residues), see Phobius details amino acids 325 to 350 (26 residues), see Phobius details PF00375: SDF" amino acids 16 to 395 (380 residues), 224.2 bits, see alignment E=1.5e-70

Best Hits

Swiss-Prot: 100% identical to SSTT_SHEAM: Serine/threonine transporter SstT (sstT) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K07862, serine/threonine transporter (inferred from 100% identity to saz:Sama_2200)

MetaCyc: 67% identical to serine/threonine:Na+ symporter (Escherichia coli K-12 substr. MG1655)
RXN-22449; RXN0-4083

Predicted SEED Role

"Sodium/dicarboxylate symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7P9 at UniProt or InterPro

Protein Sequence (405 amino acids)

>Sama_2200 serine/threonine transporter SstT (RefSeq) (Shewanella amazonensis SB2B)
MSTEKSLLANAAGGSLVLQIFVGIIAGVALAGFSPEAANQVAFLGDLFVGALKAIAPVLV
FVLVASSIANQVSGAQTNMRPIILLYLVGTFAAALTAVLMSFAFPTSLVLIDAAAGANPP
EGIGQVLNTLLFKLVDNPVNALINANYIGLLAWGVGLGIALRHASTSTKNMLHDVSHGVS
QLVRFVICLAPIGIFGLVAATIAQTGFEALAAYAQLLGVLLGAMAVIAFVVNPLIVFLKI
RRNPYPLVFKCLRESGVTAFFTRSSAANIPVNMALCERLKLHEDTYSVSIPLGATINMAG
AAITITVLTLAAVHTLGIEVDLATALLLSVIAAVSACGASGVAGGSLLLIPLACSLFGIS
NDIAMQVVAVGFTIGVIQDSAETALNSSTDVLFTAAACEAAERKA