Protein Info for Sama_2147 in Shewanella amazonensis SB2B

Annotation: colicin V production protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 50 (20 residues), see Phobius details amino acids 64 to 87 (24 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details PF02674: Colicin_V" amino acids 4 to 141 (138 residues), 137 bits, see alignment E=2.4e-44

Best Hits

Swiss-Prot: 61% identical to CVPA_ECOLI: Colicin V production protein (cvpA) from Escherichia coli (strain K12)

KEGG orthology group: K03558, membrane protein required for colicin V production (inferred from 100% identity to saz:Sama_2147)

Predicted SEED Role

"Colicin V production protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S7J6 at UniProt or InterPro

Protein Sequence (162 amino acids)

>Sama_2147 colicin V production protein (RefSeq) (Shewanella amazonensis SB2B)
MVWIDYAIIFIIGLSTLISLIRGFAKEAMSLLVWFAAFFVASQFYEDLAVHLTQLQDEML
RNGVAIAILFVTTLILGALVNYILGQLVAKTGLSGTDRLLGLCFGALRGALIVSAILFFM
DAFTGAPNTPWWKESRLVPEFGVVIQWFFHYLENTSSFVPKI