Protein Info for Sama_2099 in Shewanella amazonensis SB2B

Updated annotation (from data): UMP phosphatase (EC 3.1.3.5)
Rationale: Specifically important for: Thymidine. Probably required for thymidine utilization because it allows overflow metabolism of pyrimidine intermediates, as with umpH from E. coli (which is 72% identical), see PMID 23903661
Original annotation: UMP phosphatase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00702: Hydrolase
  • amino acids 1 to 212 (212 residues), 51.2 bits, E=4.4e-17
• PF13344: Hydrolase_6
  • amino acids 4 to 103 (100 residues), 78 bits, E=9.9e-26
• TIGR01460: HAD hydrolase, family IIA
  • amino acids 4 to 221 (218 residues), 188.8 bits, E=1.4e-59
• PF13419: HAD_2
  • amino acids 161 to 218 (58 residues), 25.2 bits, E=3.4e-09
• PF13242: Hydrolase_like
  • amino acids 172 to 240 (69 residues), 76.1 bits, E=3.2e-25

Best Hits

Swiss-Prot: 72% identical to NAGD_ECO57: Ribonucleotide monophosphatase NagD (nagD) from Escherichia coli O157:H7

KEGG orthology group: K02566, NagD protein (inferred from 100% identity to saz:Sama_2099)

MetaCyc: 72% identical to UMP phosphatase (Escherichia coli K-12 substr. MG1655)
5'-nucleotidase. [EC: 3.1.3.5]

Predicted SEED Role

"Phosphatase NagD predicted to act in N-acetylglucosamine utilization subsystem" in subsystem Chitin and N-acetylglucosamine utilization

MetaCyc Pathways

• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• adenosine nucleotides degradation II (3/5 steps found)
• guanosine nucleotides degradation III (2/4 steps found)
• guanosine nucleotides degradation I (1/4 steps found)
• guanosine nucleotides degradation II (1/4 steps found)
• ureide biosynthesis (3/7 steps found)
• adenosine nucleotides degradation I (3/8 steps found)
• superpathway of guanosine nucleotides degradation (plants) (1/6 steps found)
• purine nucleotides degradation I (plants) (4/12 steps found)
• NAD salvage (plants) (3/11 steps found)
• tunicamycin biosynthesis (1/9 steps found)
• superpathway of purines degradation in plants (4/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Sequence Analysis Tools

See A1S7E8 at UniProt or InterPro

Protein Sequence (248 amino acids)

>Sama_2099 UMP phosphatase (EC 3.1.3.5) (Shewanella amazonensis SB2B)
MKNIICDIDGVLLHDNKLVPGSDKFIHRVLEQGNPLVILTNYPVQTGKDLQNRLDAAGIN
VPEECFYTAAMATADFLKHQEGSKAFVIGEGALTHELYKAGFTITDINPDFVIVGETRSY
NWDMIHKAARFVADGARFIATNPDTHGPAFSPACGALCAPIERITGRKPFYVGKPSSWIV
RSALNHINGHSENTVIIGDNMRTDILAGFQAGLETILVLTGVSRLEDIEKEPFRPNHVFN
CAGDIDIF