Protein Info for Sama_2096 in Shewanella amazonensis SB2B

Name: upp
Annotation: uracil phosphoribosyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01091: uracil phosphoribosyltransferase
  • amino acids 2 to 208 (207 residues), 293.4 bits, E=4.4e-92
• PF14681: UPRTase
  • amino acids 7 to 207 (201 residues), 228.2 bits, E=7.4e-72
• PF00156: Pribosyltran
  • amino acids 64 to 168 (105 residues), 53.1 bits, E=2.4e-18

Best Hits

Swiss-Prot: 100% identical to UPP_SHEAM: Uracil phosphoribosyltransferase (upp) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K00761, uracil phosphoribosyltransferase [EC: 2.4.2.9] (inferred from 100% identity to saz:Sama_2096)

MetaCyc: 84% identical to uracil phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Uracil phosphoribosyltransferase. [EC: 2.4.2.9]

Predicted SEED Role

"Uracil phosphoribosyltransferase (EC 2.4.2.9)" in subsystem De Novo Pyrimidine Synthesis or LMPTP YwlE cluster (EC 2.4.2.9)

MetaCyc Pathways

• superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• pyrimidine nucleobases salvage I (1/1 steps found)
• pyrimidine nucleobases salvage II (1/2 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.9

Sequence Analysis Tools

See A1S7E5 at UniProt or InterPro

Protein Sequence (208 amino acids)

>Sama_2096 uracil phosphoribosyltransferase (RefSeq) (Shewanella amazonensis SB2B)
MKVVEVKHPLVRHKIGLMREADISTKRFRELAAEVGSLLTYEATADLETETVTIEGWNGP
VQVEQIKGKKVTVVPILRAGLGMMDGVLEHIPSARISVVGIYRDEETLEPVPYFEKLCSQ
VDERIALVVDPMLATGGSMISTIDLLKQRGCKQIKALVLVAAPEGLAALEKAHPDIELYT
ASIDRCLNENGYILPGLGDAGDKIFGTK