Protein Info for Sama_2045 in Shewanella amazonensis SB2B

Annotation: aminodeoxychorismate lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K02619, 4-amino-4-deoxychorismate lyase [EC: 4.1.3.38] (inferred from 100% identity to saz:Sama_2045)

Predicted SEED Role

"Aminodeoxychorismate lyase (EC 4.1.3.38)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis (EC 4.1.3.38)

MetaCyc Pathways

superpathway of chorismate metabolism (50/59 steps found)
superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
4-aminobenzoate biosynthesis I (2/2 steps found)
4-aminobenzoate biosynthesis II (1/2 steps found)
superpathway of candicidin biosynthesis (2/11 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.38

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S794 at UniProt or InterPro

Protein Sequence (296 amino acids)

>Sama_2045 aminodeoxychorismate lyase (RefSeq) (Shewanella amazonensis SB2B)
MAILTMESGKGKATARLNWLDLTLESTESAHAQSISPMDRGLAYGDGLFATMALTPTGDV
AFLDTHLSRLHQGACRLGFVLDLKDIKSRLVLAAKAQANQQTPRGLKLLISRGPGGRGYQ
APDDASPIAVLSAFDVPAHYREWQRKGICLFSSELQLAKQPKLAGMKHLNRLEQVLIRTQ
QMPDWAQDFLVSDTDGALIEASMANLIFITGGTAYTPYHAFAGVSGVMREQIIHALLERG
YRVVADKLDPDMLVKAQAVIMCNSLLGLVDVVRIDNFHYQVFTESQSIRDALELNL