Protein Info for Sama_2033 in Shewanella amazonensis SB2B

Annotation: lipoprotein Blc (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 176 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF08212: Lipocalin_2" amino acids 31 to 170 (140 residues), 107.6 bits, see alignment E=2.9e-35

Best Hits

Swiss-Prot: 46% identical to BLC_CITFR: Outer membrane lipoprotein Blc from Citrobacter freundii

KEGG orthology group: K03098, outer membrane lipoprotein Blc (inferred from 100% identity to saz:Sama_2033)

Predicted SEED Role

"lipoprotein Blc"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S782 at UniProt or InterPro

Protein Sequence (176 amino acids)

>Sama_2033 lipoprotein Blc (RefSeq) (Shewanella amazonensis SB2B)
MNWRLFLISIIMIYWLSACSSQRLPVIQDFEVTQYLGTWHEIARMENRFEKGLSQVTAEY
RQEGDHIMVINRGYSAAEQRWKQAVGKARFEGASDEGRLEVSFFGPFYGDYQILAASRNA
DGQYRTALVSGNSFDYLWLLSREPSLTDEERVYFTDKIRALGVNPDTLVWLDGSAK