Protein Info for Sama_2014 in Shewanella amazonensis SB2B

Annotation: sulfate permease family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 109 to 130 (22 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details amino acids 262 to 281 (20 residues), see Phobius details amino acids 335 to 351 (17 residues), see Phobius details amino acids 357 to 377 (21 residues), see Phobius details amino acids 391 to 420 (30 residues), see Phobius details PF00916: Sulfate_transp" amino acids 30 to 396 (367 residues), 290.9 bits, see alignment E=1.3e-90 PF01740: STAS" amino acids 451 to 535 (85 residues), 39.5 bits, see alignment E=4.2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_2014)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S763 at UniProt or InterPro

Protein Sequence (592 amino acids)

>Sama_2014 sulfate permease family protein (RefSeq) (Shewanella amazonensis SB2B)
MDESKGVCVSRLLSLMPGLASFKDYRKEWFKDDVRAAFSVSAVALPVAIAYAQLTGVNAL
VGLYSCVLPMMVYALFGTSRQLIVGPDAATCAVVAAVVTPLAAGDSIKHWQLAMTMTAMT
GFWCLIASRFKLGVLADFLSKPILMGLLNGVAITIIVGQASKILGFSFDERYLLDRIAAA
PGYLSQIHWATLAMSLGAVLIFLLVKRFRPTWPAAMLVIVVSTLVAWAANLEQFDVALVG
DVSINMPAFQMPAFDIGIARELVMPALNLAMVSFVSMMLTARSFAAKNGYDIDPDKEFRA
LGIANIASALSQGFAVSGADSRTAVNDASGGKTQLVSLIAALIIGIIAWLFTAPLAFIPS
AALGVVLVVASWSLLDLKTLWKLRKRDQRAFLLAMTTFVAVLLIGVIPGITLAVLLGLFQ
FLQVVMRPSDQCLGLDAKGTLRSLDGSDKAVAVPGVFIYRFNSPLTYFNASYFKRRLLER
IAAEPETPECVIIDAVPCFTHPDISVMAMLSDLYALLKRRHIRLILAGRKRQLLSWCEAQ
GIPTGEGGLLIRSDLYLALKMNQAYKQALADGQAPVLKRPVDLDLVLEHSHL