Protein Info for Sama_2008 in Shewanella amazonensis SB2B

Annotation: cystathionine beta-lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 PF01053: Cys_Met_Meta_PP" amino acids 10 to 388 (379 residues), 387.1 bits, see alignment E=6.9e-120 TIGR01324: cystathionine beta-lyase" amino acids 10 to 390 (381 residues), 513.7 bits, see alignment E=1.2e-158 PF00155: Aminotran_1_2" amino acids 39 to 187 (149 residues), 20.6 bits, see alignment E=2.4e-08

Best Hits

Swiss-Prot: 51% identical to METC_SALTY: Cystathionine beta-lyase (metC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01760, cystathionine beta-lyase [EC: 4.4.1.8] (inferred from 100% identity to saz:Sama_2008)

Predicted SEED Role

"Cystathionine beta-lyase (EC 4.4.1.8)" in subsystem Methionine Biosynthesis (EC 4.4.1.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S757 at UniProt or InterPro

Protein Sequence (401 amino acids)

>Sama_2008 cystathionine beta-lyase (RefSeq) (Shewanella amazonensis SB2B)
MSDKPMKTATKIVSLGREKKYSKGVINPPVFRASTIVFDTMEEMRHAAKNKHNGEMFYGR
RGTPTHFGFQAAIAELEGGAGTALYPSGAAAISASLLAFLQAGDHLLMVDSVYEPTRDLC
DKVLKGYGIETTYYDPLIGAGIEALIRPNTRVLFVESPGSITMEVQDVPTLARIAHEHGL
VVILDNTWASPINSRPFELGVDVSIQAATKYIVGHSDVMMGTATASPQYWDKLREHSYLL
GQTTSPDDVYLAARGLRTLGVRMAQHEKNALAVANWLKTRPEVDHLRHPAFEECPGHEFF
KRDFSGSNGLFSFVLKRGTVDAVTAMVEGMSHFKMGFSWGGFESLILGVTGIHNIRSATR
WDSSKPLIRVHIGLEDPEDLIEDLSAGFVRFNEVMAKETQG