Protein Info for Sama_1975 in Shewanella amazonensis SB2B

Annotation: 2-hydroxy-3-oxopropionate reductase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF01488: Shikimate_DH" amino acids 2 to 70 (69 residues), 33 bits, see alignment E=1.5e-11 PF03446: NAD_binding_2" amino acids 3 to 160 (158 residues), 167.9 bits, see alignment E=4.7e-53 PF03807: F420_oxidored" amino acids 3 to 67 (65 residues), 44.8 bits, see alignment E=3.9e-15 PF02737: 3HCDH_N" amino acids 3 to 83 (81 residues), 22.6 bits, see alignment E=2.2e-08 PF14833: NAD_binding_11" amino acids 166 to 283 (118 residues), 119 bits, see alignment E=3.8e-38

Best Hits

Swiss-Prot: 79% identical to Y1503_SHEFN: Uncharacterized oxidoreductase Sfri_1503 (Sfri_1503) from Shewanella frigidimarina (strain NCIMB 400)

KEGG orthology group: K00042, 2-hydroxy-3-oxopropionate reductase [EC: 1.1.1.60] (inferred from 100% identity to saz:Sama_1975)

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S724 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Sama_1975 2-hydroxy-3-oxopropionate reductase (RefSeq) (Shewanella amazonensis SB2B)
MAKVAFLGLGVMGYPMAGHLVKAGHQVTVYNRTTAKAEAWVKQFGGAMALSPKLAAEDQD
IVFTCVGNDKDLHQVVLGEDGVIHGLNAGAVLVDHTTASADIAREIGAALNAQGFGFVDA
PVSGGQAGAENGVLTVMAGGDEAVFNQVKDVIMSYARCAERLGETGAGQLTKMVNQICIA
GVVQGLAEALHFARSAGLDGEKVVEVISKGAAQSWQMENRYKSMWAGEYNFGFAIDWMRK
DLGIALEEARRNGSHLPLTALVDQFYSEVQGMGGNRWDTSSLMARLEKSRK