Protein Info for Sama_1974 in Shewanella amazonensis SB2B
Updated annotation (from data): Cytidine deaminase (EC 3.5.4.5)
Rationale: Specifically important for utilizing Cytidine. Automated validation from mutant phenotype: the predicted function (CYTIDEAM2-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: cytidine deaminase (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CDD_SHEAM: Cytidine deaminase (cdd) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)
KEGG orthology group: K01489, cytidine deaminase [EC: 3.5.4.5] (inferred from 100% identity to saz:Sama_1974)Predicted SEED Role
"Cytidine deaminase (EC 3.5.4.5)" in subsystem Murein hydrolase regulation and cell death (EC 3.5.4.5)
MetaCyc Pathways
- superpathway of pyrimidine ribonucleosides salvage (9/10 steps found)
- superpathway of pyrimidine deoxyribonucleosides degradation (6/6 steps found)
- superpathway of pyrimidine deoxyribonucleoside salvage (8/9 steps found)
- pyrimidine deoxyribonucleosides degradation (3/3 steps found)
- pyrimidine ribonucleosides salvage I (3/3 steps found)
- pyrimidine ribonucleosides degradation (2/2 steps found)
- pyrimidine deoxyribonucleosides salvage (4/5 steps found)
- pyrimidine ribonucleosides salvage II (1/2 steps found)
- superpathway of pyrimidine ribonucleosides degradation (2/5 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 3.5.4.5
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A1S723 at UniProt or InterPro
Protein Sequence (296 amino acids)
>Sama_1974 Cytidine deaminase (EC 3.5.4.5) (Shewanella amazonensis SB2B) MQDRFVRRINELPKALADELLPMLGEQFCGHLDAQQVKQLCAVSAMDSHELGLALLPIAA ALAKPPVSNFYVGAIAVGSGGDFYMGANLELQGEALFHSVHAEQSAISHAWLSGETQISD IIVNASPCGHCRQFMNELVQGQAIRIHLPGQDTAPLSHYLPYAFGPADLNVTAPLLSKQQ TELVLESDDPLLIEALDHAGLSYAPYSQCHAAVVLETEDGASFCGRYAENAAFNPSMLPM QMALSALVRHNRSFSDIKRAVLLESSQGKISLVGATMDALHAVAVVELEHLVVDPV