Protein Info for Sama_1964 in Shewanella amazonensis SB2B

Annotation: spermidine synthase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 216 to 236 (21 residues), see Phobius details PF17284: Spermine_synt_N" amino acids 7 to 57 (51 residues), 46.4 bits, see alignment 3e-16 TIGR00417: spermidine synthase" amino acids 8 to 278 (271 residues), 343.2 bits, see alignment E=4.9e-107 PF01564: Spermine_synth" amino acids 60 to 241 (182 residues), 220.7 bits, see alignment E=1.2e-69

Best Hits

Swiss-Prot: 61% identical to SPEE_ERWT9: Polyamine aminopropyltransferase (speE) from Erwinia tasmaniensis (strain DSM 17950 / CIP 109463 / Et1/99)

KEGG orthology group: K00797, spermidine synthase [EC: 2.5.1.16] (inferred from 100% identity to saz:Sama_1964)

MetaCyc: 60% identical to spermidine synthase (Escherichia coli K-12 substr. MG1655)
Spermidine synthase. [EC: 2.5.1.16]; 2.5.1.- [EC: 2.5.1.16]

Predicted SEED Role

"Spermidine synthase (EC 2.5.1.16)" in subsystem Polyamine Metabolism (EC 2.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.16

Use Curated BLAST to search for 2.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S713 at UniProt or InterPro

Protein Sequence (291 amino acids)

>Sama_1964 spermidine synthase (RefSeq) (Shewanella amazonensis SB2B)
MQDNNLYFETLHSGYGQYFEIDKVLFEQKTSQWHLSIFENARFGRVMALNGAIQTTEADE
FVYHEMLTHVPVLAHGQVKSLLIIGGGDGGMLREVVKHQAIERIVMVEIDSAVVDMCKTW
LPNHSAGAYDDPRVELVIADGMDFVANCAERFDVIISDCTDPVGPGEVLFSSDFYAGCKR
CLNENGIFVAQNGVPFMQVESLQDTVRRMSSYTRECWFYMAAVPTYIGGSMAFAWATDNP
EARKLDLATLEARFNEAGISTRYYTPAVHQASFALPKYVEQAIRSAMTVTA