Protein Info for Sama_1963 in Shewanella amazonensis SB2B

Annotation: arginine decarboxylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01273: arginine decarboxylase
  • amino acids 4 to 634 (631 residues), 869.3 bits, E=8.2e-266
• PF02784: Orn_Arg_deC_N
  • amino acids 85 to 346 (262 residues), 156.9 bits, E=9.7e-50
• PF17810: Arg_decarb_HB
  • amino acids 370 to 457 (88 residues), 93.6 bits, E=1.1e-30
• PF17944: Arg_decarbox_C
  • amino acids 585 to 633 (49 residues), 47.3 bits, 3.7e-16

Best Hits

Swiss-Prot: 100% identical to SPEA_SHEAM: Biosynthetic arginine decarboxylase (speA) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K01585, arginine decarboxylase [EC: 4.1.1.19] (inferred from 100% identity to saz:Sama_1963)

MetaCyc: 56% identical to biosynthetic arginine decarboxylase (Escherichia coli K-12 substr. MG1655)
Arginine decarboxylase. [EC: 4.1.1.19]

Predicted SEED Role

"Biosynthetic arginine decarboxylase (EC 4.1.1.19)" in subsystem Acid resistance mechanisms or Arginine and Ornithine Degradation or Polyamine Metabolism (EC 4.1.1.19)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (14/17 steps found)
• L-arginine degradation IV (arginine decarboxylase/agmatine deiminase pathway) (3/3 steps found)
• putrescine biosynthesis II (3/3 steps found)
• arginine dependent acid resistance (1/1 steps found)
• superpathway of polyamine biosynthesis II (6/8 steps found)
• L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (1/2 steps found)
• putrescine biosynthesis I (1/2 steps found)
• superpathway of polyamine biosynthesis I (5/8 steps found)
• spermidine biosynthesis III (2/4 steps found)
• superpathway of putrescine biosynthesis (2/4 steps found)
• superpathway of L-arginine and L-ornithine degradation (8/13 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (6/11 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.19

Sequence Analysis Tools

See A1S712 at UniProt or InterPro

Protein Sequence (636 amino acids)

>Sama_1963 arginine decarboxylase (RefSeq) (Shewanella amazonensis SB2B)
MNEWSIDDARAGYNVAHWSQGFYGISDEGEVTVSPDPKNPTFKIGLNALAKDMVKAGVSL
PVLVRFPQILHHRVDHLCQMFNQAIQKYEYQSDYLLVYPIKVNQQQTVVEEILASQVSKT
VPQLGLEAGSKPELMAVLAMAQKASSVIVCNGYKDKEYIRLALIGEKLGHSVYIVLEKMS
ELQMVLEESKKLGVTPRLGLRARLAFQGKGKWQASGGEKSKFGLSAAQILKVVERLKDED
MLESLQLLHFHLGSQIANIRDIRHGVGEAARFYCELRKLGAKVNCFDVGGGLAVDYDGTR
SQSNNSMNYALAEYANNIVSVLTDVCNQNEQPMPRIISESGRYLTAHHAVLITDVIGTEA
YSPEDIPAPEEEAPQLLHNMWRSWNEISSRLDQRALIEIFHDTQSDLAEAQSLFALGQLS
LEDRAWAEQCNLAVCHELQGLMNARNRYQRPIIDELNEKLADRFFVNFSLFQSLPDAWGI
DQVFPVLPLSGLDKVPERRAVMLDITCDSDGIVDQYVDGQGIETTLPVPNWSAEDPYLIG
FFLVGAYQEILGDLHNLFGDTNSAVVRIDEEGQTNIESVLAGDTVADVLRYVNLDAVSFM
RTYEELVNSHIAEDERAMILEELQVGLKGYTYLEDF