Protein Info for Sama_1848 in Shewanella amazonensis SB2B

Annotation: gonadoliberin III-related protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 337 to 364 (28 residues), see Phobius details amino acids 374 to 397 (24 residues), see Phobius details amino acids 403 to 424 (22 residues), see Phobius details amino acids 436 to 456 (21 residues), see Phobius details amino acids 463 to 485 (23 residues), see Phobius details PF14400: Transglut_i_TM" amino acids 24 to 182 (159 residues), 163.1 bits, see alignment E=5.4e-52 PF14402: 7TM_transglut" amino acids 254 to 497 (244 residues), 358.9 bits, see alignment E=1.5e-111

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1848)

Predicted SEED Role

"FIG139976: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6P7 at UniProt or InterPro

Protein Sequence (500 amino acids)

>Sama_1848 gonadoliberin III-related protein (RefSeq) (Shewanella amazonensis SB2B)
MHSRKPFYIFVFLLVVLGISSSIYRGVEHRVPFLPGEQVNTWAIDAKVSFIGQGGESEVS
LALPQDPAFEVLLEHTTSAGFGLAMMDDADGRRALWSKRAVLGQQDLYYKVTLVPTGISR
LVEDIEPKTPEAPVWAATEQTAAQEVIDAAWERSGSNLSYARQLVTLVGTEKSQNLALLL
TAQTPSRLFINLLAAKGVPAREVSALFLEDQRRRQQLVPFVEVYDQGEWYLFDATSGKEG
RPENLLLWERQGKSVLDVIGGNNSQVSFSMLMETRPALATSIDMMETTQGLDFSLYQLPL
EEQSLFKGILLIPIGVLMVVFLRVIIGIKTSGTFMPVLIALAFIQTTLLTGLVGFLLIVA
CGLMIRSYLSHLNLLLISRISAVIIVVIGIIGIFTLLSYKFGLSEGLTITFFPMIILAWT
IERMSILWEEEGAKEVVLQGGGSLLVATLAYLAMSASWVQHWVFNFLGIHLVILALVMLM
GQYTGYRLLELKRFKPLAGE