Protein Info for Sama_1791 in Shewanella amazonensis SB2B

Annotation: cytochrome c oxidase, cbb3-type, subunit I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 478 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 132 to 153 (22 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details amino acids 352 to 372 (21 residues), see Phobius details amino acids 386 to 407 (22 residues), see Phobius details amino acids 436 to 459 (24 residues), see Phobius details TIGR00780: cytochrome c oxidase, cbb3-type, subunit I" amino acids 11 to 466 (456 residues), 761 bits, see alignment E=2.6e-233 PF00115: COX1" amino acids 16 to 445 (430 residues), 404.7 bits, see alignment E=2.6e-125

Best Hits

Swiss-Prot: 78% identical to CCON1_PSEST: Cbb3-type cytochrome c oxidase subunit CcoN1 (ccoN1) from Pseudomonas stutzeri

KEGG orthology group: K00404, cb-type cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 100% identity to saz:Sama_1791)

MetaCyc: 79% identical to cbb3-1 cytochrome c oxidase subunit N (Pseudomonas putida KT2440)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase subunit CcoN (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6J0 at UniProt or InterPro

Protein Sequence (478 amino acids)

>Sama_1791 cytochrome c oxidase, cbb3-type, subunit I (RefSeq) (Shewanella amazonensis SB2B)
MMNHSQPHGADYNYTVVRQFALTTVLWGIVGMSVGVLIAAQLIWPQLNFDTPWLTYSRLR
PLHTNAVIFAFGTSALFATSYYVVQRTCQTRLFAPALASFTFWGWQAIILAAAITLPLGI
TSGKEYAELEWPIDIAIAVVWVSYAIVFFGTIVKRKTSHIYVANWFFGAFIITVAVLHIV
NSMAVPVSLWKSYSIYAGAVDAMVQWWYGHNAVGFLLTAGFLGMMYYFVPKQAGRPVYSY
RLSIVHFWALIALYIWAGPHHLHYTALPDWTQSLGMVMSLILFAPSWGGMINGIMTLSGA
WHKLRTDPVLRFLVVSLSFYGMSTFEGPMMAIKTVNALSHYTDWTVGHVHSGALGWVAMV
SIGSLYHLIPNLFGHGRMYSTSLVNVHFWLATIGTVLYIVAMWISGVMQGLMWRAVNSDG
TLTYSFVESLEASYPFYFVRFLGGCFFVTGMLIMAYNVFRTVKAPKDSLPALSEAKAA