Protein Info for Sama_1774 in Shewanella amazonensis SB2B

Annotation: recombination factor protein RarA (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF05496: RuvB_N" amino acids 18 to 140 (123 residues), 49.8 bits, see alignment E=1.4e-16 PF07728: AAA_5" amino acids 51 to 137 (87 residues), 25.8 bits, see alignment E=3.8e-09 PF00004: AAA" amino acids 51 to 159 (109 residues), 69.1 bits, see alignment E=2.1e-22 PF16193: AAA_assoc_2" amino acids 188 to 262 (75 residues), 77.5 bits, see alignment E=3.1e-25 PF12002: MgsA_C" amino acids 263 to 429 (167 residues), 212.3 bits, see alignment E=1.7e-66

Best Hits

Swiss-Prot: 66% identical to RARA_ECOL6: Replication-associated recombination protein A (rarA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K07478, putative ATPase (inferred from 100% identity to saz:Sama_1774)

Predicted SEED Role

"FIG065221: Holliday junction DNA helicase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6H3 at UniProt or InterPro

Protein Sequence (442 amino acids)

>Sama_1774 recombination factor protein RarA (RefSeq) (Shewanella amazonensis SB2B)
MSLSFDFSPDFNPLAARMRPASVEEYIGQSHLLGEGKPLRQALLAGKVHSMLLWGPPGTG
KTTLAELVARYANAHVERISAVTSGVKEIRAAIEQAKNVAQSRGQRTLLFVDEVHRFNKS
QQDAFLPFIEDGTVIFIGATTENPSFEVNNALLSRCRVYLIKRLEDDAIGQILAQANSDE
ARGLGKRGLLLKAELKSAIARLCDGDARKALNLLELMSDLLPDGGEYNLELLSEVAGHQA
AGYDKNGDQYYDLISAVHKSIRGSAPDAALYWFCRILEGGGDPLYVARRLLAIASEDIGN
ADPNAMTVALNAWDCFHRVGPAEGERAIAQAVIYLASAPKSNAVYTAFKAARVLARETGN
APVPNHLRNAPTKLMSELGVGEGYRYAHDEDGAFAAGENYFPEVLQHSRIYQPTARGFEK
RIRDKLAHLDALNQQSGRKRYE