Protein Info for Sama_1755 in Shewanella amazonensis SB2B

Annotation: cation efflux family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 35 to 57 (23 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 99 to 120 (22 residues), see Phobius details amino acids 133 to 155 (23 residues), see Phobius details amino acids 224 to 244 (21 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 30 to 356 (327 residues), 201.1 bits, see alignment E=1.1e-63 PF01545: Cation_efflux" amino acids 35 to 281 (247 residues), 127.4 bits, see alignment E=3.2e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1755)

Predicted SEED Role

"Cation efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6F4 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Sama_1755 cation efflux family protein (RefSeq) (Shewanella amazonensis SB2B)
MPSSMNAKPFHSVAHWQHSHDFFKHNDAGERSTRIVLVLTLVTMVAEILAGTVYGSMALL
ADGWHMGTHAAAFLITLFAYRYALKHKDDPAFAFGTGKVSVLGGFASAVALGLVALIMVI
ESAVRLISPHQIAFDEAILVAIIGLSVNLLSAFLLKDHHHHHHHHHGHHHEEDDHETHLH
HHEEGNCHHDHSQVGADHHSHEHHDHDHDHQHHHGHHDHNLRAAYLHVLADALTSVLAIG
ALLAGKFFGLGWLDPLIGILGAIIIGRWAVGLVKDTGPLLLDADNNEKLRKNVIRLVASV
PDHGVSDLHLWRISADHRACILGVVSHQPKSSDYFVKRLKDELGLHHVTVEVHCCDCEVR
PSSQD