Protein Info for Sama_1754 in Shewanella amazonensis SB2B

Annotation: ecotin (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF03974: Ecotin" amino acids 56 to 176 (121 residues), 158.6 bits, see alignment E=3.5e-51

Best Hits

Swiss-Prot: 61% identical to ECOT_SHEON: Ecotin (eco) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K08276, ecotin (inferred from 100% identity to saz:Sama_1754)

Predicted SEED Role

"Proteinase inhibitor I11, ecotin precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6F3 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Sama_1754 ecotin (RefSeq) (Shewanella amazonensis SB2B)
MQKAFSVKNLMLTGLFSLATLSVAHATSPAHPDGVNQNMITAQHFTSADYQAQEASKMFP
APAAGMVQHILTLPALENEGNYMVEVQIGQTKLVDCNKHGLRGELQTRDLQGWGYNYYEV
TEIGEGPSTMMACFDKAKTEAFVRIPGDYKFAYNSKLPMVFYIPEGAELKYRVWRADTVF
NTSKN