Protein Info for Sama_1722 in Shewanella amazonensis SB2B

Name: ansA
Annotation: cytoplasmic asparaginase I (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR00519: L-asparaginase, type I" amino acids 4 to 335 (332 residues), 366.5 bits, see alignment E=5.7e-114 PF00710: Asparaginase" amino acids 6 to 190 (185 residues), 209.1 bits, see alignment E=4.7e-66 PF17763: Asparaginase_C" amino acids 212 to 326 (115 residues), 104 bits, see alignment E=4.7e-34

Best Hits

KEGG orthology group: K01424, L-asparaginase [EC: 3.5.1.1] (inferred from 100% identity to saz:Sama_1722)

Predicted SEED Role

"L-asparaginase I, cytoplasmic (EC 3.5.1.1)" (EC 3.5.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.1

Use Curated BLAST to search for 3.5.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6C1 at UniProt or InterPro

Protein Sequence (337 amino acids)

>Sama_1722 cytoplasmic asparaginase I (RefSeq) (Shewanella amazonensis SB2B)
MKKPSIYVAYTGGTIGMQKTANGFAPVAGFLTQCVQSMPEFYHEEMPEFVIHEYDPLIDS
SNMSPAHWQMIADDIRNNYGKYDGFVILHGTDTMAYTASALSFMLQGLGKPVIVTGSQIP
LAQLRSDGQTNLLNALYIAARYPVAEVCLFFNNKLFRGNRTTKAHADGFDAFASPNFPLL
LEAGITINLKAGKITREATGQLEVACISPQPVGVVTLYPGISTDIFINVLQQPVKALILL
TFGVGNAPQDPALLNTLKEADERGVVLVNLTQCFQGKVNMGGYATGNALARAGVISGADM
TIEACLAKLHFLLSKNLPPADIKAAMQTNLVGELTSD