Protein Info for Sama_1711 in Shewanella amazonensis SB2B

Annotation: dihydrolipoamide acetyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 PF00364: Biotin_lipoyl" amino acids 4 to 73 (70 residues), 64.8 bits, see alignment E=1.1e-21 amino acids 116 to 187 (72 residues), 59 bits, see alignment E=6.5e-20 PF02817: E3_binding" amino acids 227 to 261 (35 residues), 55.1 bits, see alignment 1.4e-18 PF00198: 2-oxoacid_dh" amino acids 294 to 524 (231 residues), 285.8 bits, see alignment E=5e-89

Best Hits

KEGG orthology group: K09699, 2-oxoisovalerate dehydrogenase E2 component (dihydrolipoyl transacylase) [EC: 2.3.1.168] (inferred from 100% identity to saz:Sama_1711)

Predicted SEED Role

"Dihydrolipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC 2.3.1.168)" in subsystem Isoleucine degradation or Leucine Degradation and HMG-CoA Metabolism or Valine degradation (EC 2.3.1.168)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.168

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S6B1 at UniProt or InterPro

Protein Sequence (527 amino acids)

>Sama_1711 dihydrolipoamide acetyltransferase (RefSeq) (Shewanella amazonensis SB2B)
MIKDFILPDIGEGVVECELVEWLVKEGDHIAEDQPICDVMTDKALVQIPAPFAGVVSKLY
YAKGEIAKVHAPLYAVEMEGEGTDASAAPAEANAQAAHDSVPVAAPVAVAGKQVEDFLLP
DIGEGIVECELVEWLVNEGDTVEEDQPIADVMTDKALVQIPALKAGKIVTLHYRKGQLAK
VHAPLYAIEVDAEHPVVPPAAAPAAAANQAERVAPSTAAVNGNGKALASPAVRRMARSLD
VDLSLVPGSGKHGRVYKEDIEQYLKGGAAPAPVAQTAAPQAAVTQSAPVLPAADDRVEPI
RGVKAAMARQMMDSVSSIPHFTYCEEIDLTELVALRERMKAKYSSDDVKLTMMPFFMKSL
SLALTEFPVVNSQVNADCTELTYKASHNIGMAVDSKVGLLVPNVKDVQSKSILDVAREIT
RLTDAARSGRVSPADLKGGTISISNIGALGGTVATPIINKPEVAIVALGKLQTLPRFGAD
GSVQARKIMQVSWSGDHRVIDGGTIARFCNLWKQYLEQPEDMLLAMR