Protein Info for Sama_1663 in Shewanella amazonensis SB2B

Annotation: glucose/galactose transporter (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 137 (24 residues), see Phobius details amino acids 157 to 179 (23 residues), see Phobius details amino acids 192 to 210 (19 residues), see Phobius details amino acids 235 to 261 (27 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 303 to 319 (17 residues), see Phobius details amino acids 325 to 349 (25 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 386 to 405 (20 residues), see Phobius details PF07690: MFS_1" amino acids 31 to 360 (330 residues), 75.5 bits, see alignment E=2e-25 TIGR01272: glucose/galactose transporter WARNING" amino acids 104 to 403 (300 residues), 423.9 bits, see alignment E=2.3e-131

Best Hits

Swiss-Prot: 65% identical to GLUP_BRUAB: Glucose/galactose transporter (gluP) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02429, MFS transporter, FHS family, L-fucose permease (inferred from 100% identity to saz:Sama_1663)

Predicted SEED Role

"Predicted glucose transporter in maltodextrin utilization gene cluster" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S663 at UniProt or InterPro

Protein Sequence (415 amino acids)

>Sama_1663 glucose/galactose transporter (RefSeq) (Shewanella amazonensis SB2B)
MASGVPVTARHEGASEGGRYGFALTSLTTLFFMWGFITCLNDILIPHLKAVFSLNYAQAM
LIQFCFFGAYFLVSVPAGVLVKRLGYQKGIVVGLLTAALGCGLFYPAAVSATYGVFLGAL
FVLASGITVLQVAANPYVTALGPVQTASSRLTLTQAFNSLGTTIAPAFGSVLILSVAVGA
SAEAEADAVKLPYLLLCGMLIVLAVVFALLKLPHIHDQEDEVAATGQSALAHRHLVLGAI
GIFVYVGGEVAIGSFLVNFLGESHVAGMAEADAAHYIAFYWGGAMVGRFIGAAVMQKVDA
GKVLGFNATMAALLVLVAMNSSGALAMWAILAVGLFNSIMFPTIFSLALKNLGPATAQGS
GILCLAIVGGALVPLLQGLLADSVGLSASFILPVLCYGYILFYGLKGCKPVAAKA