Protein Info for Sama_1589 in Shewanella amazonensis SB2B
Updated annotation (from data): adhesin-associated sorting protein (DUF1329)
Rationale: Conserved cofit with a putative adhesin (Sama_1588). DUF1329 is distantly related to lolB, which inserts lipoproteins into the outer membrane. So we predict that DUF1329 is involved in sorting the adhesin to the outer membrane.
Original annotation: hypothetical protein (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 53% identical to Y3922_PSEAE: Uncharacterized protein PA3922 (PA3922) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: None (inferred from 100% identity to saz:Sama_1589)Predicted SEED Role
"FIG002188: hypothetical protein"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A1S5Z0 at UniProt or InterPro
Protein Sequence (454 amino acids)
>Sama_1589 adhesin-associated sorting protein (DUF1329) (Shewanella amazonensis SB2B) MKKLAILSAAVMFALGGGAAVAKVSEAEAAKLGTSLTPMGGEMAASADGSIPAWNGGITA APAGYKKGDHHPDPYSADKVEYTVTKANLEQYKSLLTPGQIKLFELYPDTFKMNVYKTQR SASAPQWVYDATKANASRAELVQGGNGVVGAAVGIPFPIPQNGLEAIWNHILRFRGVDIE TQRNQAAPAKGGGYTLVELSEQLRFEYSQPDMTPEKLKENNTLALFKQVVTQPARLAGTA LLVKETLDQEALPRQAWTYNTGQRRVRKAPNVAFDTPGTVSDGLRTTDDYDMFNGSPSRY NWELVGKKEILIPYNDYKLHSDKVKYDDILTPGHINPDLVRWEKHRVWEVKATLKDGMRH IYKTRVFFLDEDSWQVSATDMYDNRDELYRVAFAHGLNYYEVPAHWSTLEVFHDLQSRRY LAIGLDNEGSMYDFDAKLSASDFTPDALRREGVR