Protein Info for Sama_1568 in Shewanella amazonensis SB2B

Annotation: 4-hydroxyphenylpyruvate dioxygenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 88% identical to MELA_SHECO: Protein MelA (melA) from Shewanella colwelliana

KEGG orthology group: K00457, 4-hydroxyphenylpyruvate dioxygenase [EC: 1.13.11.27] (inferred from 100% identity to saz:Sama_1568)

Predicted SEED Role

"4-hydroxyphenylpyruvate dioxygenase (EC 1.13.11.27)" in subsystem Aromatic amino acid degradation or Homogentisate pathway of aromatic compound degradation or Plastoquinone Biosynthesis or Tocopherol Biosynthesis (EC 1.13.11.27)

MetaCyc Pathways

L-tyrosine degradation I (4/5 steps found)
plastoquinol-9 biosynthesis I (1/3 steps found)
superpathway of plastoquinol biosynthesis (2/5 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (3/9 steps found)
vitamin E biosynthesis (tocopherols) (1/7 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5W9 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Sama_1568 4-hydroxyphenylpyruvate dioxygenase (RefSeq) (Shewanella amazonensis SB2B)
MASETNPLGLLGIEFTEFATPDNDFMHKVFLDFGFSMLKKHKEKDIYYYQQNDINFLMNR
DRAGFSAGFAKSHGPAITSMGWRVEDAEYAYKHAVERGAKAAPDDVKDLPYPAIYGIGDS
LIYFIDRFGDDNIYATDFVDLDEPVIVQEKGFMEVDHLTNNVYKGTMEQWSNFYKDVFGF
TEVRYFDIKGSQTALISYALRSPDGSFCIPINEGKGDDRNQIDEYLREYNGPGVQHLAFR
SRDIVASLDAMEGSSIATLDIIPEYYDTIFEKLPQVTEDRERIKHHQILVDGDENGYLLQ
IFTKNLFGPIFIEIIQRKNNLGFGEGNFKALFESIERDQVRRGVL