Protein Info for Sama_1502 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 transmembrane" amino acids 28 to 46 (19 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 156 to 174 (19 residues), see Phobius details amino acids 180 to 205 (26 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 241 to 259 (19 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 365 to 385 (21 residues), see Phobius details amino acids 405 to 430 (26 residues), see Phobius details amino acids 441 to 461 (21 residues), see Phobius details amino acids 467 to 487 (21 residues), see Phobius details amino acids 496 to 518 (23 residues), see Phobius details PF03606: DcuC" amino acids 25 to 515 (491 residues), 437.6 bits, see alignment E=2.3e-135

Best Hits

Swiss-Prot: 61% identical to YFCC_ECOLI: Putative basic amino acid antiporter YfcC (yfcC) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1502)

Predicted SEED Role

"Putative S-transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5Q3 at UniProt or InterPro

Protein Sequence (520 amino acids)

>Sama_1502 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MTTRPDPSSGATAIAPSPRTCTWVMPDTLVIIFFVALFAALMTYLVPVGSFDTQTVTFVQ
DGVEKTRQVVDPDSFRYDLDEQGEPKLAPVPAFDPQGKGFFNYMFEGLVSGDKWGSAVGV
IMFMLVIGGSFGVVMATGTIDNGILRLIHHTQGREFVFIPVLFSLFSLGGAVFGMGEEAI
AFAIIICPLMIRLGYDGITTVMVTYVATQVGFGASWMNPFSVAIAQGIAGIPVLSGAAVR
IPMWIGFTLLGIAFTMLYARKIKAAPALSYSYATDAHFRQVQQGSDDQNPAGNSRFNLGD
YLVLATIIATMVWVIWGVVAKHWFIPEIASQFFTMGLVAGLIAVMFNLNGLTLNGMAKAF
KDGAATMLEPCLLVGSAAGILILLGKGGPTEPSVLNSILSAAGGFIGHLPDALSAWFMLL
FQSVFNFFVTSGSGQAALTMPLMAPLADIVGVSRQVAVLAFQLGDGFTNVLVPTSASLMA
TLGVCRVEFSAWVKFIWRFMLLLLIAASVMVIGAHFLGFN