Protein Info for Sama_1423 in Shewanella amazonensis SB2B
Annotation: succinate dehydrogenase, cytochrome b556 subunit (RefSeq)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 59% identical to DHSC_SALTY: Succinate dehydrogenase cytochrome b556 subunit (sdhC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K00241, succinate dehydrogenase cytochrome b-556 subunit (inferred from 100% identity to saz:Sama_1423)MetaCyc: 58% identical to succinate:quinone oxidoreductase, membrane protein SdhC (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Succinate dehydrogenase cytochrome b-556 subunit" in subsystem Succinate dehydrogenase
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A1S5H4 at UniProt or InterPro
Protein Sequence (131 amino acids)
>Sama_1423 succinate dehydrogenase, cytochrome b556 subunit (RefSeq) (Shewanella amazonensis SB2B) MELSEQNVKKQRPVHLDLQTIHFPATAKVSILHRVSGVIMLFAMGILIWLLHASLASAES FQGVQALFDNFLVKFVIWGILTALGYHLLGGIRHLVMDTGRWEELGSGNASAKAVFVLAI TFSIIAGIWVW