Protein Info for Sama_1355 in Shewanella amazonensis SB2B

Annotation: phage integrase family site specific recombinase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 TIGR02249: integron integrase" amino acids 6 to 318 (313 residues), 401.6 bits, see alignment E=1.3e-124 PF13495: Phage_int_SAM_4" amino acids 6 to 90 (85 residues), 98 bits, see alignment E=3.3e-32 PF00589: Phage_integrase" amino acids 107 to 304 (198 residues), 128 bits, see alignment E=3.5e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1355)

Predicted SEED Role

"Integron integrase IntI2" in subsystem Integrons

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S5A6 at UniProt or InterPro

Protein Sequence (318 amino acids)

>Sama_1355 phage integrase family site specific recombinase (RefSeq) (Shewanella amazonensis SB2B)
MTHSPFLNAVRDSIRLRGYSLRTEKTYLHWIKFYILFNQKRHPDTMGSAEITAFLTYLAV
ERHVAANTQKVALNALIYLYQKFLQIELGELPFSLATKQRSLPIVVTQTEVAHILAKLSG
VHLHVIQMLYGSGLRVTECLRLRVQDVDLERLSVTVHDGKGNKDRQTLLSRSCLNWLPDQ
IEHSLNIQQKDNQRGIGPSMPTALSVKYPNAFREPGWMYLFPSSGLCPHPITGEICRHHL
HDSAIRKALRIAVRHAGVRKKVNCHTFRHSFATHLLQAGYDIRTVQELLGHNDVKTTQIY
THVLGQHYAGTVSPLDRL