Protein Info for Sama_1332 in Shewanella amazonensis SB2B

Annotation: lipoprotein releasing system transmembrane protein LolE (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 21 to 48 (28 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 320 to 346 (27 residues), see Phobius details amino acids 353 to 372 (20 residues), see Phobius details amino acids 377 to 397 (21 residues), see Phobius details TIGR02212: lipoprotein releasing system, transmembrane protein, LolC/E family" amino acids 6 to 411 (406 residues), 442.9 bits, see alignment E=5.5e-137 PF12704: MacB_PCD" amino acids 27 to 244 (218 residues), 53.9 bits, see alignment E=3e-18 PF02687: FtsX" amino acids 279 to 404 (126 residues), 46.6 bits, see alignment E=3.4e-16

Best Hits

KEGG orthology group: K09808, lipoprotein-releasing system permease protein (inferred from 100% identity to saz:Sama_1332)

Predicted SEED Role

"Lipoprotein releasing system transmembrane protein LolC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S583 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Sama_1332 lipoprotein releasing system transmembrane protein LolE (RefSeq) (Shewanella amazonensis SB2B)
MFSSSAFLIGYRYWRARKANAFASFITLFAVSGIFLGVAALIVVSSVMNGLEGQLKTRIL
GAVPQVVVEKNDGFADWRQTADQLQATLPGIVGVSPSTGTQAMLQSSSNIGAVQLSGILP
EVESALASRTTTVYSPAFDSLISGEYRIILGVQLASELDVAVGDTIRVLSGEGVVFSPLG
PVPSQRKFIVSGLFQMGSQVDAQLAFIHYDDARRLMRKAPDKVDGLRLYLDDPFEAEATG
KAVPQILAAEGDTLNVHDWRDGYGHLFGAVKMEKNMTSLMLSLIVAVAAFNIVSALVMMV
VDKTTDVAVLMTQGLTRSAVMGIFVTQGSLNALLGLVLGLIAGLVLTLNLNPLLSALGIA
VLGAGQPLPVIIAAEQLWLIVIGTVAITLLATLYPALRASRVEPASALRYE