Protein Info for Sama_1296 in Shewanella amazonensis SB2B

Name: hscB
Annotation: co-chaperone HscB (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 TIGR00714: Fe-S protein assembly co-chaperone HscB" amino acids 13 to 171 (159 residues), 124.6 bits, see alignment E=1.9e-40 PF07743: HSCB_C" amino acids 88 to 165 (78 residues), 66.9 bits, see alignment E=8.5e-23

Best Hits

Swiss-Prot: 100% identical to HSCB_SHEAM: Co-chaperone protein HscB homolog (hscB) from Shewanella amazonensis (strain ATCC BAA-1098 / SB2B)

KEGG orthology group: K04082, molecular chaperone HscB (inferred from 100% identity to saz:Sama_1296)

Predicted SEED Role

"Chaperone protein HscB" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S547 at UniProt or InterPro

Protein Sequence (174 amino acids)

>Sama_1296 co-chaperone HscB (RefSeq) (Shewanella amazonensis SB2B)
MNYFELFNLPVAFDVNTSELADKYRELQRTVHPDKFAAASEQEKLLAVSRTAMVNDGFQT
LKDPIRRAEHMLALKGVDIRHETQTVRDTAFLMQQMEWREALEEITHADDPHCLIADLYQ
SFGDFQKQVTAKLKTLLVSEDDNDLQAAADQVRKLKFMAKLHVELERAEDALLD