Protein Info for Sama_1294 in Shewanella amazonensis SB2B

Annotation: scaffold protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 127 PF01592: NifU_N" amino acids 2 to 126 (125 residues), 182.7 bits, see alignment E=1.5e-58 TIGR01999: FeS cluster assembly scaffold IscU" amino acids 3 to 125 (123 residues), 226.9 bits, see alignment E=2.7e-72

Best Hits

Swiss-Prot: 86% identical to ISCU_ECOLI: Iron-sulfur cluster assembly scaffold protein IscU (iscU) from Escherichia coli (strain K12)

KEGG orthology group: K04488, nitrogen fixation protein NifU and related proteins (inferred from 100% identity to saz:Sama_1294)

MetaCyc: 86% identical to scaffold protein for iron-sulfur cluster assembly (Escherichia coli K-12 substr. MG1655)
RXN-14381

Predicted SEED Role

"Iron-sulfur cluster assembly scaffold protein IscU" in subsystem Wyeosine-MimG Biosynthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S545 at UniProt or InterPro

Protein Sequence (127 amino acids)

>Sama_1294 scaffold protein (RefSeq) (Shewanella amazonensis SB2B)
MAYSEKVIDHYENPRNVGSFDKNDPSVVTGMVGAPACGDVMKLQLKINDAGIIEDAKFKT
YGCGSAIASSSLVTEWVKGKSIEEAAAIKNTDIAEELALPPVKIHCSILAEDAIKAALEE
YKHKQAK