Protein Info for Sama_1255 in Shewanella amazonensis SB2B

Annotation: MotA/TolQ/ExbB proton channel family protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 273 to 298 (26 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details amino acids 399 to 423 (25 residues), see Phobius details PF01618: MotA_ExbB" amino acids 319 to 435 (117 residues), 100.5 bits, see alignment E=3e-33

Best Hits

KEGG orthology group: K03561, biopolymer transport protein ExbB (inferred from 100% identity to saz:Sama_1255)

Predicted SEED Role

"MotA/TolQ/ExbB proton channel family protein" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S506 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Sama_1255 MotA/TolQ/ExbB proton channel family protein (RefSeq) (Shewanella amazonensis SB2B)
MKKLISTAVVAASLSLTAGMVSAADAPKTIDQLLQQVKTERTAEGKVNAKREAEFKAERG
DKASLLQREKSALAAEKQRGQDLNQAFIDNERKIAQLEEDLKTAQGDLGEMFGVVKGEAG
DFAGKLVGSNVSAQYPKRDVFIADLGSRKQLPKIEELEKFWQEQLFEMAESGKVVKFEAA
VTDIDGNVVNTTVHRIGSFNLTADGKYVVYNPELGLIQQLSAQPEGYQVAPIAKWEATTS
GAAKLYIDPARGTLLNIFTQKASFQDRIEAGGVIGYIIIGLLALGLLIGLERLLTLFVIG
SKVKSQAKNVANPGNNALGRILKVYQDNKDADVETLELKLDEAILKETPAIETRISIIKV
LAAIAPMMGLLGTVTGMIATFQSIQLFGTGDPKLMAGGISMALVTTVQGLVAALPLMLVH
AIVVARSKTIVQTLEEQSAGIIAEHAEKRAN