Protein Info for Sama_1185 in Shewanella amazonensis SB2B

Annotation: steroid dehydrogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 282 to 299 (18 residues), see Phobius details PF05368: NmrA" amino acids 23 to 133 (111 residues), 33.6 bits, see alignment E=1.3e-11 PF04321: RmlD_sub_bind" amino acids 24 to 270 (247 residues), 53.2 bits, see alignment E=9.6e-18 PF01370: Epimerase" amino acids 25 to 235 (211 residues), 111 bits, see alignment E=2.7e-35 PF02719: Polysacc_synt_2" amino acids 25 to 132 (108 residues), 35.3 bits, see alignment E=3.1e-12 PF16363: GDP_Man_Dehyd" amino acids 26 to 171 (146 residues), 50.9 bits, see alignment E=7e-17 PF01073: 3Beta_HSD" amino acids 26 to 266 (241 residues), 158.5 bits, see alignment E=7.6e-50 PF13460: NAD_binding_10" amino acids 29 to 186 (158 residues), 55.7 bits, see alignment E=2.5e-18 PF07993: NAD_binding_4" amino acids 81 to 228 (148 residues), 37.1 bits, see alignment E=7.9e-13

Best Hits

Swiss-Prot: 62% identical to OLED_SHEON: 2-alkyl-3-oxoalkanoate reductase (oleD) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1185)

MetaCyc: 62% identical to hentriaconta-3,6,9,12,19,22,25,28-octaene-16-one-15-oate reductase (Shewanella oneidensis MR-1)
RXN-18561 [EC: 1.1.1.412]

Predicted SEED Role

"NAD(P)H steroid dehydrogenase-like protein in alkane synthesis cluster"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.412

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4T6 at UniProt or InterPro

Protein Sequence (351 amino acids)

>Sama_1185 steroid dehydrogenase (RefSeq) (Shewanella amazonensis SB2B)
MTQAYPLHPAQLEAAKRLKTHVSRVLVTGAGGFLGQALCRQLLSAGIEVVGIARSAYPAL
AAMGVEMHRGDIMDLKALSAAMNGCELVFHVASKAGVWGSRESYYGPNVTGAANVLQASQ
DLGIKAIVYTSTPSVTFDGKDESGIDESAPYAAHFLNHYGASKAEAEAMMLRASSPSLVI
TALRPHLIWGPKDPHLVPRVLERGRAGRLRLLGAEDKLVDTIYVDNAAHAHVLAAIALLE
KPGECGGRAFFLSNGEPVTMASMLSKILACAELPGVTRRVPVWLAYGMGAVLEGMYTLLG
KQDEPLMTRFVARQLSCSHYYDISAAREILDYEPLISLDEGMARLKASLQP