Protein Info for Sama_1178 in Shewanella amazonensis SB2B

Annotation: Beta-lactamase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00753: Lactamase_B" amino acids 47 to 215 (169 residues), 52.8 bits, see alignment E=2.5e-18

Best Hits

Swiss-Prot: 39% identical to BLAB_SERMA: Metallo-beta-lactamase type 2 from Serratia marcescens

KEGG orthology group: K01467, beta-lactamase [EC: 3.5.2.6] (inferred from 100% identity to saz:Sama_1178)

Predicted SEED Role

"Beta-lactamase" in subsystem Beta-lactamase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.2.6

Use Curated BLAST to search for 3.5.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4S9 at UniProt or InterPro

Protein Sequence (238 amino acids)

>Sama_1178 Beta-lactamase (RefSeq) (Shewanella amazonensis SB2B)
MRIAISWCTALMIGTIANTQALEITPLSDGLFLHQSEKEVEGFGKVSANGLIIVDGKEAF
VVDTPWTDADAEALLEWTKAKDLTVKAVLATHWHEDRAGSFGVFERAGIATLSSEATQAL
LRQHQKTLATHTFSGDEIQYFGNKVEVFYPGAGHAMDNLVVYLPHEKLLFGGCLVREAST
RFMGFYGDGSLPDWPESMSRLIAKFPEVITVVPGHGALGDKRLLEHTRGLAEAALKAQ