Protein Info for Sama_1144 in Shewanella amazonensis SB2B

Annotation: phosphatidate cytidylyltransferase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 6 to 40 (35 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 87 to 109 (23 residues), see Phobius details amino acids 122 to 144 (23 residues), see Phobius details amino acids 151 to 174 (24 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 219 to 238 (20 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details PF01148: CTP_transf_1" amino acids 3 to 280 (278 residues), 216.4 bits, see alignment E=3.4e-68

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 100% identity to saz:Sama_1144)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4P5 at UniProt or InterPro

Protein Sequence (285 amino acids)

>Sama_1144 phosphatidate cytidylyltransferase (RefSeq) (Shewanella amazonensis SB2B)
MLKQRIITAIWLIPLVFGAIFYLPSSIFAWALVGVFLIAAKEWGRIIDAGCQMTQWSFTL
TLGILLVALNILVPASEVWHSGQLHPIFLAVTLLGGFWWVIAMALVVTYPKSARLWQRSH
MLKSMFGQLTLLPCFVALIALKSLSTDASPYFGGVMVFLVMLVVWAADSGAYFVGKALGR
TKLAPNVSPAKTVEGLVGGLLTTMIVVAIVMSLSPQQELGLVIAVTLFTALASALGDLTE
SMFKRVANIKDSGTILPGHGGVLDRIDSLTAALPVFTLIYIAFWM