Protein Info for Sama_1118 in Shewanella amazonensis SB2B

Annotation: elongation factor G (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 682 PF00009: GTP_EFTU" amino acids 8 to 263 (256 residues), 108.2 bits, see alignment E=1.2e-34 PF01926: MMR_HSR1" amino acids 12 to 134 (123 residues), 29.9 bits, see alignment E=1.6e-10 PF03144: GTP_EFTU_D2" amino acids 307 to 373 (67 residues), 37.7 bits, see alignment E=6.9e-13 PF14492: EFG_III" amino acids 389 to 461 (73 residues), 74.7 bits, see alignment E=1.4e-24 PF03764: EFG_IV" amino acids 464 to 583 (120 residues), 144 bits, see alignment E=5.8e-46 PF00679: EFG_C" amino acids 586 to 671 (86 residues), 69.9 bits, see alignment E=4.8e-23

Best Hits

KEGG orthology group: K02355, elongation factor G (inferred from 100% identity to saz:Sama_1118)

Predicted SEED Role

"Translation elongation factor G-related protein" in subsystem Translation elongation factor G family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4L9 at UniProt or InterPro

Protein Sequence (682 amino acids)

>Sama_1118 elongation factor G (RefSeq) (Shewanella amazonensis SB2B)
MAEYQTARIRNFALLGHTGAGKSSLLEALLYGARVINQRGRVDKGTNHADFTAQEKAHQH
SLEPSFLNLDFDEHHINLIDTPGLPDFFGRALLPLPAVESVLLVVNAATGIEPVTARAFE
AARAQGKVVCICVNHIDGHLDKLPAIIEELQTTFGPRCLPVNLPSADGNDVVDCYLHCED
TRPTLFSQAASARDELVDTVLEEDEALMTLYLEQGEMLSAEQLHEPLETALRMGHLVPIC
FTSAELDIGIASLLEIMVKLMPSPLEANPPQFIKGFGDKAVPVDVTQSPDDHVLAQVFRV
GIDPYFGRVAVFRLYQGTLEAGMRLFIGADRKPVKVAHLIKLQGAETTEVEKAIPGDICA
LCKIDELEVGSVLHDSHDEDEFHLRELKMPQPIFGLAVSPKRRGDEQKIAEVLAKLIAED
PSLAVSQNDAEGQTVLSGLGDLHLQIALEKAQSVFRVDMETCKPAVAYRETVCKAATARY
RHKKQSGGAGQFGEVELTVEPLPRGQGFEFVSKVVGGAVPTQFIPAVEKGVREALKVGRL
GGYPVEDVRVTVLDGKHHSVDSKEIAFVMAGKKAFYEAFLQANPVILEPLVSMEILVSAE
DVGDITGHLSSSRAMVCGTEARRDGKVKVLAEAPLSTVDDYATRLKSMTSGEGEFTLSFA
RYEVVPPAVQQSLLRTIEDKDD