Protein Info for Sama_1071 in Shewanella amazonensis SB2B

Annotation: response regulator receiver protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 117 (17 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details PF20969: MASE11" amino acids 15 to 182 (168 residues), 177.6 bits, see alignment E=3e-56 PF13487: HD_5" amino acids 226 to 377 (152 residues), 58.1 bits, see alignment E=1.5e-19 PF01966: HD" amino acids 230 to 346 (117 residues), 39.1 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_1071)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4H2 at UniProt or InterPro

Protein Sequence (394 amino acids)

>Sama_1071 response regulator receiver protein (RefSeq) (Shewanella amazonensis SB2B)
MSKLSRDEYPTDLAHWRQIIFRRLFGAMAIICVPVYITSVYLCVKQGLWSMVVVDTLAYL
VLIAMLLFPELEDKQRYLMGSLLCYGIGVAFIWSIGPTGAGFFWLFMFPLIGTLLLGRRF
GIYCLMLTALTLIIMGLGFTAQWVPWPELPDYSLEIYLVVVLNFLTINVMLCLATGFLTD
KLSDSLERTHASRRATVLGLARLSGFKDADSARHLNRIAKASELLTQALLSSPHRPDELT
PEFAENIGLSATLHDIGMIGVADNLQSKQLTMTPDMESERYKHTLIGDRLLGELLREAPD
CVLLAMARDIAAYHHERWDGEGFPGKLKGKSIPLAARVVALIDTVDDLLCHPDPRFRMTY
EQARTHIKGLKGSILDPLLVDTFLSEPAMREIWH