Protein Info for Sama_1067 in Shewanella amazonensis SB2B

Annotation: putative sulfate transporter YchM (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 572 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 32 to 54 (23 residues), see Phobius details amino acids 61 to 81 (21 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 134 to 153 (20 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details amino acids 282 to 304 (23 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details amino acids 361 to 392 (32 residues), see Phobius details amino acids 412 to 442 (31 residues), see Phobius details PF00916: Sulfate_transp" amino acids 30 to 414 (385 residues), 277.9 bits, see alignment E=1.2e-86 PF01740: STAS" amino acids 463 to 557 (95 residues), 48.5 bits, see alignment E=6.4e-17

Best Hits

KEGG orthology group: K03321, sulfate permease, SulP family (inferred from 100% identity to saz:Sama_1067)

Predicted SEED Role

"Putative sulfate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4G8 at UniProt or InterPro

Protein Sequence (572 amino acids)

>Sama_1067 putative sulfate transporter YchM (RefSeq) (Shewanella amazonensis SB2B)
MPHRHHLTSLIPAFALRQSLLGERYSRAELLADLLAGITVGVIAIPLAMALAIASGVAPQ
YGLYTAIIAGIIIAISGGSKLSVSGPTAAFVVLLAPISAQYGLGGLLLATVMSGVILLLM
SLMRLGRLIQYIPEPVTLGFTGGIAIVIAMLQIKDMFALPVEALPEDFWHKVSTLFHAMP
HAQWPSILVAAITLSVLVFWPKFTQKLPPHLPAILAGTLCALALGGLGFDVETIGSRFSF
TLDDGTLMAGIPSVLPSFLLPWELPGVGGEPLTLNWQLVQNLLPSAMAIAMLGAIESLLC
AVVVDGMTGNRHSANSELFGQGLGNLIAPFFGAIPATAAIARSAANVRAGAKSPLAAVFH
ALTVLLALVLLAPVLAYIPMATMAALLLVVAWHMSEAKKSLHLIRRAHVSDVAVLLTCLM
LTVAFDMVIAIGVGIVLASLLLMGQLAASTRLVALDCGSDAGSPNIEAFRIDGPLFFAAA
DNLFSELMHRQNGAPILVLDWQNVSLLDAGGLSALERTVAWAQKQGREIRIVSVPFQALR
ALVKAGVQEKPGVLSFYPDMTAALQDTVTNTD