Protein Info for Sama_1052 in Shewanella amazonensis SB2B

Annotation: oxaloacetate decarboxylase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 PF00682: HMGL-like" amino acids 5 to 268 (264 residues), 65.9 bits, see alignment E=5.8e-22 TIGR01108: oxaloacetate decarboxylase alpha subunit" amino acids 7 to 593 (587 residues), 877.4 bits, see alignment E=2.3e-268 PF02436: PYC_OADA" amino acids 292 to 491 (200 residues), 201.5 bits, see alignment E=1.9e-63 PF00364: Biotin_lipoyl" amino acids 534 to 597 (64 residues), 63.9 bits, see alignment E=1.5e-21

Best Hits

Swiss-Prot: 64% identical to DCOA_SALTI: Oxaloacetate decarboxylase alpha chain (oadA1) from Salmonella typhi

KEGG orthology group: K01571, oxaloacetate decarboxylase, alpha subunit [EC: 4.1.1.3] (inferred from 100% identity to saz:Sama_1052)

Predicted SEED Role

"Oxaloacetate decarboxylase alpha chain (EC 4.1.1.3)" in subsystem Na+ translocating decarboxylases and related biotin-dependent enzymes or Pyruvate metabolism I: anaplerotic reactions, PEP (EC 4.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.3

Use Curated BLAST to search for 4.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S4F3 at UniProt or InterPro

Protein Sequence (599 amino acids)

>Sama_1052 oxaloacetate decarboxylase (RefSeq) (Shewanella amazonensis SB2B)
MTKALALTDVVLRDAHQSLLATRLRIEDMLPIAAKLDQVGYWSLETWGGATFDACIRYLG
EDPWERLRLLKQAMPNTPMQMLLRGQNLLGYRHYADDLVHRFVERAHDNGMDVFRVFDAM
NDVRNLQEAVRAVKQVGAHAQGTISYTTSPVHNLDTWVDMAKRLEDLGCDSLCIKDMAGL
LRPMEAFELVSRLKSQTGLMVAMHSHATTGLSTATYQKAIEAGIDVLDTAISSMSQTYGH
SATETLVAMVEDTERSTGLDMALLEEIAAYFREVRKKYAKFEGALQGIDSRILRAQVPGG
MLTNMESQLKEQGASDKLDLVLDEIPRVREDLGFLPLVTPTSQIVGTQAVINVLTGERYK
SLTKETEGVLKGEYGATPAPVNAELQQRVLKGAEPVTCRPADLLTPEMVRLRAELVQKAV
AENITLSEDLDDDVLTYALFPQIGLQFLKNRGNADAFEPVPVAVLAASSAPVRVASGPET
YTVKVDGQTYVVEVAAGGEISQIQTQGVSQSSASVAPVATAAAPVSHEIKLEMSAPLSGN
IFKIHVSPGDTVKAGDVVIILEAMKMETEIRAQADGVIARLWVKEGDSVAVGAQLLSLA