Protein Info for Sama_1017 in Shewanella amazonensis SB2B

Annotation: riboflavin synthase subunit alpha (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00187: riboflavin synthase, alpha subunit
  • amino acids 1 to 199 (199 residues), 209.3 bits, E=1.7e-66
• PF00677: Lum_binding
  • amino acids 3 to 87 (85 residues), 71.8 bits, E=1.9e-24
  • amino acids 100 to 184 (85 residues), 86.2 bits, E=6.2e-29

Best Hits

Swiss-Prot: 59% identical to RISA_PHOPO: Riboflavin synthase (ribE) from Photobacterium phosphoreum

KEGG orthology group: K00793, riboflavin synthase [EC: 2.5.1.9] (inferred from 100% identity to saz:Sama_1017)

Predicted SEED Role

"Riboflavin synthase eubacterial/eukaryotic (EC 2.5.1.9)" (EC 2.5.1.9)

MetaCyc Pathways

• flavin biosynthesis I (bacteria and plants) (9/9 steps found)
• flavin biosynthesis III (fungi) (8/9 steps found)
• flavin biosynthesis II (archaea) (6/10 steps found)

KEGG Metabolic Maps

• Riboflavin metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.9

Use Curated BLAST to search for 2.5.1.9

Sequence Analysis Tools

See A1S4B8 at UniProt or InterPro

Protein Sequence (217 amino acids)

>Sama_1017 riboflavin synthase subunit alpha (RefSeq) (Shewanella amazonensis SB2B)
MFTGIIEAVGQLRRIDRKGDDIRLTVASGKLDLSDVRLGDSIATNGVCLTVVECLADGYV
ADVSAETVKLTGFGDYRPGQAVNLEKAVTPTTRLGGHLVSGHVDGRAMVVSRSHLGKAIE
FWLEAPAELARYIAHKGSITIDGVSLTVNEVDGSRFRLTIVPHTAGETTLIDLAVGDKVN
LEVDQIARYLERLMQRGEESVSGGVTLDLLARSGFMR