Protein Info for Sama_1004 in Shewanella amazonensis SB2B

Annotation: U32 family peptidase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01136: Peptidase_U32
  • amino acids 81 to 343 (263 residues), 291 bits, E=5.5e-91
• PF16325: Peptidase_U32_C
  • amino acids 360 to 442 (83 residues), 75.4 bits, E=3.3e-25

Best Hits

Swiss-Prot: 72% identical to Y419_HAEIN: Uncharacterized protease HI_0419 (HI_0419) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 100% identity to saz:Sama_1004)

Predicted SEED Role

"Putative protease"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

See A1S4A5 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Sama_1004 U32 family peptidase (RefSeq) (Shewanella amazonensis SB2B)
MFKPELLSPAGTLKNMRYAFAYGADAVYAGQPRYSLRVRNNDFKLENLKTGIEEAHSLGK
KLYVVSNIAPHNAKLKTYLDDMAPVVAMKPDALIMSDPGLIMMVREAFPDQVVHLSVQAN
AINWASVKFWQSVGIKRVILSRELSLDEIEEIRQRCPDIELEVFVHGALCMAYSGRCLLS
GYINKRDPNQGTCTNACRWKYDAHEATENEAGDVVAIHTPESAVQLETPTLGNGPATDKI
FLLQEENRPGEYMPAFEDEHGTYIMNSKDLRAIQHVERLAKIGVDSLKIEGRTKSFYYVA
RTAQLYRQAIEDAVAGRGFDPHLMTRLEGLAHRGYTEGFLRRHVHDEYQNYDYGYSISDS
QQFVGEFTGKRNEAGLAEIDVKNKFIVGDSVELMTPQGNINLTVDTLYNRKGEAVDAGLG
SGHMVYLPVPAEVDVNMGVLLRNLPNGNNTRNPHGEAEVIPTKVE