Protein Info for Sama_0996 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 signal peptide" amino acids 1 to 45 (45 residues), see Phobius details transmembrane" amino acids 46 to 46 (1 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 161 to 184 (24 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details PF06197: DUF998" amino acids 46 to 225 (180 residues), 31.9 bits, see alignment E=5.3e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0996)

Predicted SEED Role

"FIG01060302: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S497 at UniProt or InterPro

Protein Sequence (234 amino acids)

>Sama_0996 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MPQSVSDSPRGSGNKCHKIFRLARQMFAVGMLLLCACLLGGALGFTSADNPELFSPFNHN
LSELGTYGLSPLAVLANGGVFFGGLLLSLGCLQGMRTQRGGGMLVWLLLAFTWLSLALTG
LFPSNVYHLHTLALKWFFTLGLAASLCYCLYLALRQAPVTGFWSLGLCLLALLANSAFLL
LPSLTLEGLPFSRPFYEEVYSPYPRPAFWWPATLQWLSLVTMLLWQAELFRRPD