Protein Info for Sama_0995 in Shewanella amazonensis SB2B

Annotation: putative methyl-accepting chemotaxis sensory transducer (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 transmembrane" amino acids 153 to 170 (18 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details PF08448: PAS_4" amino acids 18 to 114 (97 residues), 25.1 bits, see alignment E=4.3e-09 TIGR00229: PAS domain S-box protein" amino acids 22 to 117 (96 residues), 53.1 bits, see alignment E=1.7e-18 PF00989: PAS" amino acids 22 to 113 (92 residues), 46.2 bits, see alignment E=1.1e-15 PF13426: PAS_9" amino acids 26 to 112 (87 residues), 39.1 bits, see alignment E=2e-13 PF08447: PAS_3" amino acids 34 to 117 (84 residues), 62.1 bits, see alignment E=1.2e-20 PF00015: MCPsignal" amino acids 329 to 481 (153 residues), 112.3 bits, see alignment E=6e-36

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to saz:Sama_0995)

Predicted SEED Role

"Methyl-accepting chemotaxis sensory transducer with Pas/Pac sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S496 at UniProt or InterPro

Protein Sequence (517 amino acids)

>Sama_0995 putative methyl-accepting chemotaxis sensory transducer (RefSeq) (Shewanella amazonensis SB2B)
MSNMSKHRPINQREIRLNQDDELISTTDLRGVITYANPRFIQISGYSKQELVGHSHNIVR
HPDMPADAFAELWSKLKAGQSWRGLVKNRAKDGSFYWVDAFVTPIFEAGKIVGYQSVRRM
PQTEWVNRATRIYQRLQQGKGLPRHLSLGQKRIISALVATTGLGICGLLWGPGVMVAGAL
LMGVNLAIFYDEAFRIPARLMALQQEFDSVSRHVYCGYDTSSILDFQLLLQQARMQGVLG
RSQDQALQLQRIAENLVVASGQTEASLDMQHRQLEQLACAMEEMTATIGEVALNSRQTSE
KIRDAQQLCQHNAHAMSEKRVRIANLADAVAEAASNAEKLNREAEKVASAMSEIDAIAEQ
TNLLALNAAIEAARAGEQGRGFAVVADEVRALSSRTQQSTMSISRSVEQMFSMLGSWAEE
MGRSQQEAEACARAIAESVDDIQNIHVQISEIHDFAEQNAVASAQQETVVADMNQNLQQI
AHGANDNLAAMSLVGKATLELQSSADKASSLRQTFGH