Protein Info for Sama_0984 in Shewanella amazonensis SB2B

Annotation: TMAO reductase system periplasmic protein TorT (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 54 to 319 (266 residues), 57.8 bits, see alignment E=1.3e-19 TIGR02955: TMAO reductase system periplasmic protein TorT" amino acids 55 to 342 (288 residues), 323 bits, see alignment E=8.7e-101 PF13407: Peripla_BP_4" amino acids 58 to 305 (248 residues), 60.1 bits, see alignment E=2.5e-20

Best Hits

KEGG orthology group: K11930, periplasmic protein TorT (inferred from 100% identity to saz:Sama_0984)

Predicted SEED Role

"Periplasmic protein torT precursor" in subsystem trimethylamine N-oxide (TMAO) reductase

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S485 at UniProt or InterPro

Protein Sequence (345 amino acids)

>Sama_0984 TMAO reductase system periplasmic protein TorT (RefSeq) (Shewanella amazonensis SB2B)
MNISPRILLLLIALGFFTAEAAPWQLEQRTPFNAIEQQSKALMLTPLERAHKPWKLCVLV
PHLKDAYWIGINYGLAAQAKKLGVSFEMFEAGGYPNHDRQQTQLAHCLGGDFDAVLLGAV
TPHLLKDVPGGLNKPVLALVNKLEDPRVGTHIGVNWYQMGSLIGNAIKRQFTSEASLALL
AGPESVGGTDLVEQGIGQSLSGSKLSIGAIRHADNNRHLQREQLQQLLESSRPDAIVGSA
VAIEVAVNQFGQTPPSYPIVLGASYFSPAIARALQRGKIAAACDDKVVLQGMVAVELAVR
QLQGETAFGDIGPAIVVRTANNSDAAALIESLPPAEFYPVYRFNP