Protein Info for Sama_0950 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04264: YceI" amino acids 24 to 186 (163 residues), 139.7 bits, see alignment E=5e-45

Best Hits

Swiss-Prot: 70% identical to Y3370_SHEON: UPF0312 protein SO_3370 (SO_3370) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0950)

Predicted SEED Role

"FIG01057522: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S451 at UniProt or InterPro

Protein Sequence (190 amino acids)

>Sama_0950 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MKKTLLSALFVTSLIAVPVSAADYVIDTQGAHASINFKVNHLGYSFVVGRFNDFGGEFSF
DGKSPETAKVKVTVNTQSLDSNHAERDKHLKSADFINAGKYPEAVFESTSVKAGSDGTLV
IEGNFTLNGVTKPLTIDAVAIGEGSDPWGGYRAGFTGSTSFALKDYNINYDLGPASTHVT
LDLVVEGIRK