Protein Info for Sama_0939 in Shewanella amazonensis SB2B

Annotation: tryptophan halogenase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 507 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF04820: Trp_halogenase" amino acids 5 to 458 (454 residues), 434.5 bits, see alignment E=2.5e-134

Best Hits

KEGG orthology group: K14266, FADH2 O2-dependent halogenase I [EC: 1.14.14.7] (inferred from 100% identity to saz:Sama_0939)

Predicted SEED Role

"Tryptophan halogenase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.14.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S440 at UniProt or InterPro

Protein Sequence (507 amino acids)

>Sama_0939 tryptophan halogenase (RefSeq) (Shewanella amazonensis SB2B)
MKITKIAILGGGTAGWLAANHLGAELCADKEVEITLIESPEIPTIGVGEGTVPYIMKGLK
RFGISESELLANCDTTFKQGIKFVNWLDPERHGDNHYYHPFDSPYPGGMDISHYWLTQKD
KRPFDDVGIQARICEKNLAPKRISAPEYQGELAYAYHFNAVKFAALLAKNARERFGVKYL
SATVAGATLNDDGAIASLNTKEVGSLAFDFYVDCSGFHSVLLDKVLKVPFVDKGKELLTD
SVIVQQVPLKSGEALSPYTKATAHKAGWIWDIPLTTRRGTGFVYCSQYMSDEEAVSTFAQ
YLGMDVSEISPRKIPMKIGYREKFWAKNCATLGLAQGFVEPLEATSILVTDFSAELLAKN
FPRETSDIEVLSPYYNDVITYVWERVIDFIKLHYCLSDREDTGFWAANRDSDTWSETLKS
RLAKFALRPPQQSDFLSRFDLFDDKNFLYVLYGMGFSSRIKALDPREIEQSRQLLESNDK
LADRAEELLMEHGKWLAGLKAAMARAS