Protein Info for Sama_0886 in Shewanella amazonensis SB2B

Annotation: hypothetical protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 62 to 84 (23 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details PF01595: CNNM" amino acids 13 to 180 (168 residues), 183.4 bits, see alignment E=5e-58 PF00571: CBS" amino acids 275 to 324 (50 residues), 27.2 bits, see alignment 6.2e-10 PF03471: CorC_HlyC" amino acids 342 to 415 (74 residues), 66.8 bits, see alignment E=2.1e-22

Best Hits

Swiss-Prot: 60% identical to YFJD_ECOLI: UPF0053 inner membrane protein YfjD (yfjD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 100% identity to saz:Sama_0886)

Predicted SEED Role

"Hemolysins and related proteins containing CBS domains"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3Y7 at UniProt or InterPro

Protein Sequence (429 amino acids)

>Sama_0886 hypothetical protein (RefSeq) (Shewanella amazonensis SB2B)
MDAISTGTLLLSLLVLILISAYFSGSETAMMSLNRYRLRHLASNGHKGAKRASKLLDRPD
RLIGLILIGNNLVNILASAIATIIGMRIWGDVGVAIATGLLTVVVLVFAEVTPKTVAALH
PERIAYPSSLLLKWLLVILQPLVKVMNIITSGILRLIGIRNVATNDALSQEELRTVVHEA
GALIPQRHQDMLLSILDLEKVTVEDIMIPRAEIYAINVNDDFKQINRQVVTSPHTRVLVY
RDTIDDAVGFIHLRDALRLQSKEEFSKATLLRAVKELYFIPEGTPLNVQLANFQHNKERI
GLVVDEYGDIQGLVTLEDILEEIVGDFTTSMVPTASEEIHPQEDGSLLIDASINIRELNK
EMKWELPTDGPKTLNGLILEYLEDIPSPNTSLRLEGYPIEVMEVAENMVKTVRVMPDLYQ
APDNAKKTP