Protein Info for Sama_0854 in Shewanella amazonensis SB2B

Annotation: CobD-related protein (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 transmembrane" amino acids 6 to 31 (26 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 206 to 233 (28 residues), see Phobius details amino acids 305 to 324 (20 residues), see Phobius details PF03186: CobD_Cbib" amino acids 25 to 301 (277 residues), 112.3 bits, see alignment E=1.4e-36

Best Hits

KEGG orthology group: K02227, adenosylcobinamide-phosphate synthase CobD [EC: 6.3.1.10] (inferred from 100% identity to saz:Sama_0854)

Predicted SEED Role

"Adenosylcobinamide-phosphate synthase (EC 6.3.1.10)" (EC 6.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3V5 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Sama_0854 CobD-related protein (RefSeq) (Shewanella amazonensis SB2B)
MTESQFVSQLIALDGALFEGFLIILCALPLARLAPLPREMQPLVWFGVLARELARKVNHP
SRGPRQQLIAGIMATILLVLPFWLIIAFLLDLAAFPWFFEFLILYLCLSDASFAQVAEEV
QRALGHGDKDRARKLLRQYLSRDTAELSEAGLAKATIEKLVTAPIYGTAGVVFFYALAGA
PMVLLVRMLKQLELVWPPMSPDFRAFVAPVNLLVSALLYIPAWLWSLTLAIVGGPSGFKA
LLTPRRWQPLSNPMRAAYVAATVLNTELGGPHKYRGNRVAVDKVGKGPLPDTAKIGEAIK
LSNRACFSWLAFLLFLPLAWTLLRYSQTL