Protein Info for Sama_0850 in Shewanella amazonensis SB2B

Annotation: tyrosyl-tRNA synthetase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 TIGR00234: tyrosine--tRNA ligase" amino acids 6 to 397 (392 residues), 409.4 bits, see alignment E=9e-127 PF00579: tRNA-synt_1b" amino acids 30 to 317 (288 residues), 283.7 bits, see alignment E=8.8e-89

Best Hits

Swiss-Prot: 88% identical to SYY_SHEON: Tyrosine--tRNA ligase (tyrS) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K01866, tyrosyl-tRNA synthetase [EC: 6.1.1.1] (inferred from 100% identity to saz:Sama_0850)

Predicted SEED Role

"Tyrosyl-tRNA synthetase (EC 6.1.1.1)" (EC 6.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3V1 at UniProt or InterPro

Protein Sequence (399 amino acids)

>Sama_0850 tyrosyl-tRNA synthetase (RefSeq) (Shewanella amazonensis SB2B)
MADLDQVLAEIKRGTDEILLEADLIEKLKEGRPLRVKLGADPTAPDIHLGHTVILNKLRL
FQELGHEVIFLIGDFTGMVGDPSGKNSTRPPLTREQVLANAETYKEQVYKILDPAKTRIE
FNSSWLEQLGAAGMIRLASHQTVARMLERDDFKKRYGSGQPIAIHEFMYPLLQGWDSVAL
KADIELGGTDQKFNLLMGRELQKAEGQKPQTVIMMPLLEGLDGVKKMSKSAHNYIGVSEA
PDEMFGKLMSISDELMWRYFDLLSFRPLAEVQQFKADVEAGANPRDIKIALAKEIIARFH
DQAAADAAHQNFIDRFQKGAIPDDIEEVTLSAGAEGMAVANLLKEAGLVGSTSDAMRMIK
QGAVKMDGEKLEDAKQVFSAGLSAVFQVGKRKFAKVTLS