Protein Info for Sama_0828 in Shewanella amazonensis SB2B

Annotation: putative glycerol-3-phosphate acyltransferase PlsY (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00023: acyl-phosphate glycerol 3-phosphate acyltransferase
  • amino acids 1 to 187 (187 residues), 226.5 bits, E=1.3e-71
• PF02660: G3P_acyltransf
  • amino acids 5 to 177 (173 residues), 179.1 bits, E=3.9e-57

Best Hits

Swiss-Prot: 80% identical to PLSY_SHEON: Glycerol-3-phosphate acyltransferase (plsY) from Shewanella oneidensis (strain MR-1)

KEGG orthology group: K08591, glycerol-3-phosphate acyltransferase PlsY [EC: 2.3.1.15] (inferred from 100% identity to saz:Sama_0828)

Predicted SEED Role

"Acyl-phosphate:glycerol-3-phosphate O-acyltransferase PlsY" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• oleate biosynthesis III (cyanobacteria) (2/3 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• diacylglycerol and triacylglycerol biosynthesis (3/7 steps found)
• palmitoyl ethanolamide biosynthesis (2/6 steps found)
• superpathway of stearidonate biosynthesis (cyanobacteria) (2/6 steps found)
• stigma estolide biosynthesis (2/7 steps found)
• anandamide biosynthesis II (2/8 steps found)
• anandamide biosynthesis I (4/12 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerolipid metabolism
• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.15

Use Curated BLAST to search for 2.3.1.15

Sequence Analysis Tools

See A1S3S9 at UniProt or InterPro

Protein Sequence (195 amino acids)

>Sama_0828 putative glycerol-3-phosphate acyltransferase PlsY (RefSeq) (Shewanella amazonensis SB2B)
MILCAYLAGSVSSAVLVCKLRGLPDPRTQGSGNPGATNVLRIGGASAAAMVLLFDMLKGA
IPAYIGFKLGIDAVWLGVIAIAACLGHIFPVFFGFKGGKGVATAYGAIAPIDGYLTLLLI
VTWIVTLLITRYSSVAALATALLAPVYTWWLDDRFTIPVAMLSTLILIRHKDNIKRLLKG
EESKVSRKRRQQPQD