Protein Info for Sama_0824 in Shewanella amazonensis SB2B

Annotation: DNA primase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 TIGR01391: DNA primase" amino acids 3 to 413 (411 residues), 473.5 bits, see alignment E=2.8e-146 PF01807: Zn_ribbon_DnaG" amino acids 4 to 98 (95 residues), 133.9 bits, see alignment E=5.9e-43 PF08275: DNAG_N" amino acids 124 to 249 (126 residues), 138.3 bits, see alignment E=6.5e-44 PF13662: Toprim_4" amino acids 258 to 336 (79 residues), 60.7 bits, see alignment E=5.1e-20 PF01751: Toprim" amino acids 259 to 333 (75 residues), 59 bits, see alignment E=1.7e-19 PF13362: Toprim_3" amino acids 259 to 354 (96 residues), 30.5 bits, see alignment E=1.6e-10 PF13155: Toprim_2" amino acids 261 to 346 (86 residues), 66.6 bits, see alignment E=8.8e-22 PF10410: DnaB_bind" amino acids 368 to 416 (49 residues), 26.6 bits, see alignment 2.3e-09 PF08278: DnaG_DnaB_bind" amino acids 450 to 568 (119 residues), 101.2 bits, see alignment E=2.2e-32

Best Hits

KEGG orthology group: K02316, DNA primase [EC: 2.7.7.-] (inferred from 100% identity to saz:Sama_0824)

Predicted SEED Role

"DNA primase (EC 2.7.7.-)" in subsystem DNA-replication or Macromolecular synthesis operon (EC 2.7.7.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3S5 at UniProt or InterPro

Protein Sequence (576 amino acids)

>Sama_0824 DNA primase (RefSeq) (Shewanella amazonensis SB2B)
MAIPRDFINDLIARTDIVELIDRKVPLKKAGKNYSACCPFHSEKSPSFTVSRDKQFYHCF
GCGAHGNAIDFVMEYDRLNFVDAIEDLAGQLGLEVPREQGTGPRRDEGLARDLYQLMEEA
ARHYQTQLRQHADKQKVDEYLALRGLSKEVVEDFGIGFAPDGWDGLLGRYRTNPDAQDKL
LTGGMLIENDGGKRYDRFRDRLMFPIRDRRGRVIGFGGRVLGDGTPKYLNSPETPIFHKG
QELYGLYELKQKHRDPERVMIVEGYMDVVALAQFGIDYAVASLGTSTTAEQFQLLLRSAK
EVICCYDGDKAGYEAAWRAMETALPLLKPGDKVTFLFLPQGEDPDSQVRKEGKEAFEMRI
DNALPLADYLFDTLSQKYGTDKGNLAKQAIALIEKIKDTVLANLLLENLAHKLGMNSSED
LRKKLGLTSMSTGAKAMAKKGLKGRGTPLRLAISLLVQHPELGHKLPVQPALSHIRMTGI
ELLIQLLELTREQVLSTAQLLESYRDSEHWGPLTKLAQWEHQIAEDNVAQEFRKALVWLN
NQYIEQRYQELSIKPDLTREEKLQLQKLIVVMKGMK