Protein Info for Sama_0789 in Shewanella amazonensis SB2B

Annotation: aspartate ammonia-lyase (RefSeq)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 472 PF00206: Lyase_1" amino acids 14 to 342 (329 residues), 312 bits, see alignment E=5.1e-97 PF10415: FumaraseC_C" amino acids 408 to 460 (53 residues), 62.8 bits, see alignment 3.2e-21

Best Hits

Swiss-Prot: 64% identical to ASPA_PSEFL: Aspartate ammonia-lyase (aspA) from Pseudomonas fluorescens

KEGG orthology group: K01744, aspartate ammonia-lyase [EC: 4.3.1.1] (inferred from 100% identity to saz:Sama_0789)

MetaCyc: 57% identical to aspartate ammonia-lyase (Escherichia coli K-12 substr. MG1655)
Aspartate ammonia-lyase. [EC: 4.3.1.1]

Predicted SEED Role

"Aspartate ammonia-lyase (EC 4.3.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 4.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A1S3P0 at UniProt or InterPro

Protein Sequence (472 amino acids)

>Sama_0789 aspartate ammonia-lyase (RefSeq) (Shewanella amazonensis SB2B)
MDTRIEHDLLGDAPVPAQAWYGIQTQRALENFSLSGTPINAFPELIRALAKVKAAAARAN
QSLGQLSDIKANAIAAACDDIVQGALHDQFVVDLIQGGAGTSTNMNANEVIANLALAKLG
HGKGEYRHLHPNNDVNCSQSTNDAYPTAARLAMVEATAPLKVAIEAICLSLEVKGREFSH
ILKMGRTQLQDAVPMTLGQEFDAFASSLKSDIGRIDDACKELCVVNLGGTAIGTGINTHP
AYGVLAVKALADITGLPVTQADNLIDATTDMGAFVTLSSVLKRLAVKLSKLSNDLRLLSS
GPRTGLGEIRLPAMQPGSSIMPGKVNPVIPEAVNQVAFQVIGTDMTITMAAEAAQLQLNA
MEPVIVYNLLNNCALLTRAIAMLDSRCIQGIEANEAKCEQHVSSSIGIVTALVPHIGYEN
ATRIAGEALLSGAGVAELVRRDGLLSDDALSQILSPAAMVTPVELTGAAKAH